Lineage for d2amcb6 (2amc B:475-681)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208545Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2208546Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2208547Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2208686Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species)
    this domain is non-catalytic
  7. 2208687Species Thermus thermophilus [TaxId:274] [55704] (12 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 2208691Domain d2amcb6: 2amc B:475-681 [127008]
    Other proteins in same PDB: d2amca_, d2amcb1, d2amcb2, d2amcb3, d2amcb4, d2amcb5
    automated match to d1jjcb5
    protein/RNA complex; complexed with mg, so4, tyr

Details for d2amcb6

PDB Entry: 2amc (more details), 2.7 Å

PDB Description: crystal structure of phenylalanyl-trna synthetase complexed with l- tyrosine
PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d2amcb6:

Sequence; same for both SEQRES and ATOM records: (download)

>d2amcb6 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus [TaxId: 274]}
alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll
nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv
glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga
lhpeiaqelelppvhlfelrlplpdkp

SCOPe Domain Coordinates for d2amcb6:

Click to download the PDB-style file with coordinates for d2amcb6.
(The format of our PDB-style files is described here.)

Timeline for d2amcb6: