SCOPe 2.03: Domain d2amcb3: 2amc B:39-151

Lineage for d2amcb3 (2amc B:39-151)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.4: Myf domain [50277] (7 proteins)

6. Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)

7. Species Thermus thermophilus [TaxId:274] [50279] (11 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d2amcb3: 2amc B:39-151 [127005]
   Other proteins in same PDB: d2amca_, d2amcb1, d2amcb2, d2amcb4, d2amcb5, d2amcb6
   automated match to d1jjcb3
   protein/RNA complex; complexed with mg, so4, tyr

Details for d2amcb3

PDB Entry: 2amc, 2.7 Å

PDB Description: crystal structure of phenylalanyl-trna synthetase complexed with l- tyrosine

PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d2amcb3:

Sequence; same for both SEQRES and ATOM records:

>d2amcb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

Timeline for d2amcb3:

• d2amcb3 first appeared in SCOP 1.73
  
• d2amcb3 appears in SCOPe 2.02
  
• d2amcb3 appears in SCOPe 2.04
  
• d2amcb3 appears in the current release, SCOPe 2.08