SCOPe 2.08: Domain d2amcb1: 2amc B:1-38,B:152-190

Lineage for d2amcb1 (2amc B:1-38,B:152-190)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
   duplication: contains two such domains related by pseudo dyad

6. Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)

7. Species Thermus thermophilus [TaxId:274] [46958] (12 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d2amcb1: 2amc B:1-38,B:152-190 [127003]
   Other proteins in same PDB: d2amca_, d2amcb3, d2amcb4, d2amcb5, d2amcb6
   automated match to d1jjcb1
   protein/RNA complex; complexed with mg, so4, tyr

Details for d2amcb1

PDB Entry: 2amc, 2.7 Å

PDB Description: crystal structure of phenylalanyl-trna synthetase complexed with l- tyrosine

PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d2amcb1:

Sequence; same for both SEQRES and ATOM records:

>d2amcb1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg
lardlhalgyalvepeaa

Timeline for d2amcb1:

• d2amcb1 first appeared in SCOP 1.73
  
• d2amcb1 appears in SCOPe 2.07