| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
| Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
| Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species) |
| Species Thermus thermophilus [TaxId:274] [55702] (12 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
| Domain d2amca_: 2amc A: [127002] Other proteins in same PDB: d2amcb1, d2amcb2, d2amcb3, d2amcb4, d2amcb5, d2amcb6 automated match to d1jjca_ protein/RNA complex; complexed with mg, so4, tyr |
PDB Entry: 2amc (more details), 2.7 Å
SCOPe Domain Sequences for d2amca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2amca_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]}
rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
lrygipdiryffggrlkfleqfkgvl
Timeline for d2amca_: