Lineage for d2am5a_ (2am5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898974Family c.68.1.10: N-acetylglucosaminyltransferase I [64136] (2 proteins)
    automatically mapped to Pfam PF03071
  6. 2898980Protein automated matches [190201] (1 species)
    not a true protein
  7. 2898981Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [186947] (4 PDB entries)
  8. 2898983Domain d2am5a_: 2am5 A: [126998]
    automated match to d1fo8a_
    complexed with gol, mn, udp

Details for d2am5a_

PDB Entry: 2am5 (more details), 1.6 Å

PDB Description: Crystal Structure of N-Acetylglucosaminyltransferase I in Complex with UDP
PDB Compounds: (A:) Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase

SCOPe Domain Sequences for d2am5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2am5a_ c.68.1.10 (A:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
avipilviacdrstvrrcldkllhyrpsaelfpiivsqdcgheetaqviasygsavthir
qpdlsniavqpdhrkfqgyykiarhyrwalgqifhnfnypaavvveddlevapdffeyfq
atypllkadpslwcvsawndngkeqmvdsskpellyrtdffpglgwlllaelwaelepkw
pkafwddwmrrpeqrkgracvrpeisrtmtfgrkgvshgqffdqhlkfiklnqqfvpftq
ldlsylqqeaydrdflarvygapqlqvekvrtndrkelgevrvqytgrdsfkafakalgv
mddlksgvpragyrgivtflfrgrrvhlappqtwdgydpswt

SCOPe Domain Coordinates for d2am5a_:

Click to download the PDB-style file with coordinates for d2am5a_.
(The format of our PDB-style files is described here.)

Timeline for d2am5a_: