SCOP 1.73: Domain d2alyb6: 2aly B:475-681

Lineage for d2alyb6 (2aly B:475-681)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (3 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (15 proteins)

6. Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species)
   this domain is non-catalytic

7. Species Thermus thermophilus [TaxId:274] [55704] (9 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d2alyb6: 2aly B:475-681 [126993]
   Other proteins in same PDB: d2alya1, d2alyb1, d2alyb2, d2alyb3, d2alyb4, d2alyb5
   automatically matched to d1b70b5
   complexed with mn, so4, ysa

Details for d2alyb6

PDB Entry: 2aly, 2.6 Å

PDB Description: crystal structure of t.thermophilus phenylalanyl-trna synthetase complexed with 5'-o-[n-(l-tyrosyl)sulphamoyl]adenosine

PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOP Domain Sequences for d2alyb6:

Sequence; same for both SEQRES and ATOM records:

>d2alyb6 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus [TaxId: 274]}
alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll
nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv
glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga
lhpeiaqelelppvhlfelrlplpdkp

Timeline for d2alyb6:

• d2alyb6 is new in SCOP 1.73
  
• d2alyb6 appears in SCOP 1.75
  
• d2alyb6 appears in the current release, SCOPe 2.08