SCOPe 2.05: Domain d2alyb4: 2aly B:191-399

Lineage for d2alyb4 (2aly B:191-399)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.153: PheT/TilS domain [56036] (1 superfamily)
   core: 3 layers; contains beta-sandwich of unusual topology

4. Superfamily b.153.1: PheT/TilS domain [56037] (2 families)
   contains putative tRNA-binding structural motif

5. Family b.153.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein)
   Pfam PF03483; decorated with additional structures

6. Protein B3/B4 domain of PheRS, PheT [56039] (1 species)

7. Species Thermus thermophilus [TaxId:274] [56040] (12 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d2alyb4: 2aly B:191-399 [126991]
   Other proteins in same PDB: d2alya_, d2alyb1, d2alyb2, d2alyb3, d2alyb5, d2alyb6
   automated match to d1jjcb6
   protein/RNA complex; complexed with mn, so4, ysa

Details for d2alyb4

PDB Entry: 2aly, 2.6 Å

PDB Description: crystal structure of t.thermophilus phenylalanyl-trna synthetase complexed with 5'-o-[n-(l-tyrosyl)sulphamoyl]adenosine

PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d2alyb4:

Sequence; same for both SEQRES and ATOM records:

>d2alyb4 b.153.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus [TaxId: 274]}
lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn
yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp
lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv
paqrralsllqalagarvaealleagspk

Timeline for d2alyb4:

• d2alyb4 first appeared in SCOP 1.73
  
• d2alyb4 appears in SCOPe 2.04
  
• d2alyb4 appears in SCOPe 2.06
  
• d2alyb4 appears in the current release, SCOPe 2.08