Lineage for d2alyb3 (2aly B:39-151)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541449Family b.40.4.4: Myf domain [50277] (7 proteins)
  6. 1541459Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)
  7. 1541460Species Thermus thermophilus [TaxId:274] [50279] (11 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 1541463Domain d2alyb3: 2aly B:39-151 [126990]
    Other proteins in same PDB: d2alya_, d2alyb1, d2alyb2, d2alyb4, d2alyb5, d2alyb6
    automated match to d1jjcb3
    protein/RNA complex; complexed with mn, so4, ysa

Details for d2alyb3

PDB Entry: 2aly (more details), 2.6 Å

PDB Description: crystal structure of t.thermophilus phenylalanyl-trna synthetase complexed with 5'-o-[n-(l-tyrosyl)sulphamoyl]adenosine
PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d2alyb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2alyb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

SCOPe Domain Coordinates for d2alyb3:

Click to download the PDB-style file with coordinates for d2alyb3.
(The format of our PDB-style files is described here.)

Timeline for d2alyb3: