SCOP 1.73: Domain d2alyb2: 2aly B:400-474

Lineage for d2alyb2 (2aly B:400-474)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (7 families)

5. Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
   duplication: contains two such domains related by pseudo dyad

6. Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)

7. Species Thermus thermophilus [TaxId:274] [46958] (9 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d2alyb2: 2aly B:400-474 [126989]
   Other proteins in same PDB: d2alya1, d2alyb3, d2alyb4, d2alyb5, d2alyb6
   automatically matched to d1b70b2
   complexed with mn, so4, ysa

Details for d2alyb2

PDB Entry: 2aly, 2.6 Å

PDB Description: crystal structure of t.thermophilus phenylalanyl-trna synthetase complexed with 5'-o-[n-(l-tyrosyl)sulphamoyl]adenosine

PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOP Domain Sequences for d2alyb2:

Sequence; same for both SEQRES and ATOM records:

>d2alyb2 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
ppeaipfrpeyanrllgtsypeaeqiailkrlgcrvegegptyrvtppshrldlrleedl
veevariqgyetipl

Timeline for d2alyb2:

• d2alyb2 is new in SCOP 1.73
  
• d2alyb2 appears in SCOP 1.75
  
• d2alyb2 appears in the current release, SCOPe 2.08