Lineage for d2alya_ (2aly A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920668Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1920669Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1920670Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1920795Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species)
  7. 1920796Species Thermus thermophilus [TaxId:274] [55702] (12 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 1920799Domain d2alya_: 2aly A: [126987]
    Other proteins in same PDB: d2alyb1, d2alyb2, d2alyb3, d2alyb4, d2alyb5, d2alyb6
    automated match to d1jjca_
    protein/RNA complex; complexed with mn, so4, ysa

Details for d2alya_

PDB Entry: 2aly (more details), 2.6 Å

PDB Description: crystal structure of t.thermophilus phenylalanyl-trna synthetase complexed with 5'-o-[n-(l-tyrosyl)sulphamoyl]adenosine
PDB Compounds: (A:) phenylalanyl-tRNA synthetase alpha chain

SCOPe Domain Sequences for d2alya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2alya_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]}
rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
lrygipdiryffggrlkfleqfkgvl

SCOPe Domain Coordinates for d2alya_:

Click to download the PDB-style file with coordinates for d2alya_.
(The format of our PDB-style files is described here.)

Timeline for d2alya_: