Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species) |
Species Thermus thermophilus [TaxId:274] [55702] (11 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
Domain d2alya_: 2aly A: [126987] Other proteins in same PDB: d2alyb1, d2alyb2, d2alyb3, d2alyb4, d2alyb5, d2alyb6 automated match to d1jjca_ protein/RNA complex; complexed with mn, so4, ysa |
PDB Entry: 2aly (more details), 2.6 Å
SCOPe Domain Sequences for d2alya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2alya_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]} rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam lrygipdiryffggrlkfleqfkgvl
Timeline for d2alya_: