Lineage for d2alya1 (2aly A:85-350)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730671Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 730672Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (3 families) (S)
  5. 730673Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (15 proteins)
  6. 730788Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species)
  7. 730789Species Thermus thermophilus [TaxId:274] [55702] (9 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 730792Domain d2alya1: 2aly A:85-350 [126987]
    Other proteins in same PDB: d2alyb1, d2alyb2, d2alyb3, d2alyb4, d2alyb5, d2alyb6
    automatically matched to d1eiya2
    complexed with mn, so4, ysa

Details for d2alya1

PDB Entry: 2aly (more details), 2.6 Å

PDB Description: crystal structure of t.thermophilus phenylalanyl-trna synthetase complexed with 5'-o-[n-(l-tyrosyl)sulphamoyl]adenosine
PDB Compounds: (A:) phenylalanyl-tRNA synthetase alpha chain

SCOP Domain Sequences for d2alya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2alya1 d.104.1.1 (A:85-350) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]}
rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
lrygipdiryffggrlkfleqfkgvl

SCOP Domain Coordinates for d2alya1:

Click to download the PDB-style file with coordinates for d2alya1.
(The format of our PDB-style files is described here.)

Timeline for d2alya1: