SCOPe 2.04: Domain d2alxa_: 2alx A:

Lineage for d2alxa_ (2alx A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (9 species)

7. Species Escherichia coli [TaxId:562] [47258] (24 PDB entries)

8. Domain d2alxa_: 2alx A: [126986]
   automated match to d1av8a_
   complexed with hg, mn

Details for d2alxa_

PDB Entry: 2alx, 2.6 Å

PDB Description: ribonucleotide reductase r2 from escherichia coli in space group p6(1)22

PDB Compounds: (A:) Ribonucleoside-diphosphate reductase 1

SCOPe Domain Sequences for d2alxa_:

Sequence; same for both SEQRES and ATOM records:

>d2alxa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwl

Timeline for d2alxa_:

• d2alxa_ first appeared in SCOP 1.73, called d2alxa1
  
• d2alxa_ appears in SCOPe 2.03
  
• d2alxa_ appears in SCOPe 2.05
  
• d2alxa_ appears in the current release, SCOPe 2.08