SCOP 1.75: Domain d2alxa1: 2alx A:1-339

Lineage for d2alxa1 (2alx A:1-339)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (9 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (9 species)

7. Species Escherichia coli [TaxId:562] [47258] (23 PDB entries)

8. Domain d2alxa1: 2alx A:1-339 [126986]
   automatically matched to d1jprb_
   complexed with hg, mn

Details for d2alxa1

PDB Entry: 2alx, 2.6 Å

PDB Description: ribonucleotide reductase r2 from escherichia coli in space group p6(1)22

PDB Compounds: (A:) Ribonucleoside-diphosphate reductase 1

SCOP Domain Sequences for d2alxa1:

Sequence; same for both SEQRES and ATOM records:

>d2alxa1 a.25.1.2 (A:1-339) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwl

Timeline for d2alxa1:

• d2alxa1 first appeared in SCOP 1.73
  
• d2alxa1 is called d2alxa_ in SCOPe 2.01
  
• d2alxa1 appears in the current release, SCOPe 2.08, called d2alxa_