Lineage for d2alxa_ (2alx A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990178Protein Ribonucleotide reductase R2 [47257] (10 species)
  7. 1990212Species Escherichia coli [TaxId:562] [47258] (24 PDB entries)
  8. 1990259Domain d2alxa_: 2alx A: [126986]
    automated match to d1av8a_
    complexed with hg, mn

Details for d2alxa_

PDB Entry: 2alx (more details), 2.6 Å

PDB Description: ribonucleotide reductase r2 from escherichia coli in space group p6(1)22
PDB Compounds: (A:) Ribonucleoside-diphosphate reductase 1

SCOPe Domain Sequences for d2alxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2alxa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwl

SCOPe Domain Coordinates for d2alxa_:

Click to download the PDB-style file with coordinates for d2alxa_.
(The format of our PDB-style files is described here.)

Timeline for d2alxa_: