Lineage for d2alva1 (2alv A:2-301)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797364Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species)
    contains an extra alpha-helical domain
  7. 2797397Species SARS coronavirus [TaxId:227859] [89349] (86 PDB entries)
  8. 2797469Domain d2alva1: 2alv A:2-301 [126982]
    automatically matched to d1q2wb_
    complexed with cy6
    has additional subdomain(s) that are not in the common domain

Details for d2alva1

PDB Entry: 2alv (more details), 1.9 Å

PDB Description: x-ray structural analysis of sars coronavirus 3cl proteinase in complex with designed anti-viral inhibitors
PDB Compounds: (A:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d2alva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2alva1 b.47.1.4 (A:2-301) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
gfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllirk
snhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngs
psgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkf
ygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyep
ltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqcs

SCOPe Domain Coordinates for d2alva1:

Click to download the PDB-style file with coordinates for d2alva1.
(The format of our PDB-style files is described here.)

Timeline for d2alva1: