Lineage for d2alma1 (2alm A:-2-251)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 711303Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 711304Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 711305Family c.95.1.1: Thiolase-related [53902] (8 proteins)
  6. 711480Protein Beta-ketoacyl-ACP synthase II [53909] (5 species)
  7. 711494Species Streptococcus pneumoniae [TaxId:1313] [89793] (3 PDB entries)
  8. 711505Domain d2alma1: 2alm A:-2-251 [126978]
    automatically matched to d1ox0a1
    complexed with mg; mutant

Details for d2alma1

PDB Entry: 2alm (more details), 2.6 Å

PDB Description: Crystal structure analysis of a mutant beta-ketoacyl-[acyl carrier protein] synthase II from Streptococcus pneumoniae
PDB Compounds: (A:) 3-oxoacyl-(acyl-carrier-protein) synthase II

SCOP Domain Sequences for d2alma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2alma1 c.95.1.1 (A:-2-251) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]}
gshmklnrvvvtgygvtspigntpeefwnslatgkigiggitkfdhsdfdvhnaaeiqdf
pfdkyfvkkdtnrfdnyslyalyaaqeavnhanldvealnrdrfgvivasgiggikeied
qvlrlhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksintacsssndaigdafrs
ikfgfqdvmlvggteasitpfaiagfqaltalsttedptrasipfdkdrngfvmgegsgm
lvleslehaekrga

SCOP Domain Coordinates for d2alma1:

Click to download the PDB-style file with coordinates for d2alma1.
(The format of our PDB-style files is described here.)

Timeline for d2alma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2alma2