Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein Nitrophorin 2 (prolixin-s) [50843] (1 species) |
Species Rhodnius prolixus [TaxId:13249] [50844] (14 PDB entries) Uniprot Q26241 |
Domain d2allx_: 2all X: [126977] automated match to d1pm1x_ complexed with hem; mutant |
PDB Entry: 2all (more details), 1.47 Å
SCOPe Domain Sequences for d2allx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2allx_ b.60.1.1 (X:) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]} mdcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyn ankktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvh icvregskdlgdvytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl
Timeline for d2allx_: