![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
![]() | Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) ![]() |
![]() | Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins) |
![]() | Protein automated matches [226969] (5 species) not a true protein |
![]() | Species Semliki forest virus [TaxId:11033] [255032] (1 PDB entry) |
![]() | Domain d2alaa2: 2ala A:1-292 [126974] Other proteins in same PDB: d2alaa1 automated match to d3n40f1 |
PDB Entry: 2ala (more details), 3 Å
SCOPe Domain Sequences for d2alaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2alaa2 f.10.1.1 (A:1-292) automated matches {Semliki forest virus [TaxId: 11033]} yehstvmpnvvgfpykahierpgyspltlqmqvvetsleptlnleyitceyktvvpspyv kccgasecstkekpdyqckvytgvypfmwggaycfcdsentqlseayvdrsdvcrhdhas aykahtaslkakvrvmygnvnqtvdvyvngdhavtiggtqfifgplssawtpfdnkivvy kdevfnqdfppygsgqpgrfgdiqsrtvesndlyantalklarpspgmvhvpytqtpsgf kywlkekgtalntkapfgcqiktnpvramncavgnipvsmnlpdsaftrive
Timeline for d2alaa2: