Lineage for d2alaa1 (2ala A:293-380)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 937854Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 937890Protein Fusion glycoprotein E1 [74840] (1 species)
  7. 937891Species Semliki forest virus [TaxId:11033] [74841] (4 PDB entries)
  8. 937894Domain d2alaa1: 2ala A:293-380 [126973]
    Other proteins in same PDB: d2alaa2
    automatically matched to d1i9wa1

Details for d2alaa1

PDB Entry: 2ala (more details), 3 Å

PDB Description: Crystal structure of the Semliki Forest Virus envelope protein E1 in its monomeric conformation.
PDB Compounds: (A:) Structural polyprotein (P130)

SCOPe Domain Sequences for d2alaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2alaa1 b.1.18.4 (A:293-380) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]}
aptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagkv
tlhfstasaspsfvvslcsaratcsasc

SCOPe Domain Coordinates for d2alaa1:

Click to download the PDB-style file with coordinates for d2alaa1.
(The format of our PDB-style files is described here.)

Timeline for d2alaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2alaa2