![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Semliki forest virus [TaxId:11033] [255033] (1 PDB entry) |
![]() | Domain d2alaa1: 2ala A:293-384 [126973] Other proteins in same PDB: d2alaa2 automated match to d3n40f2 |
PDB Entry: 2ala (more details), 3 Å
SCOPe Domain Sequences for d2alaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2alaa1 b.1.18.0 (A:293-384) automated matches {Semliki forest virus [TaxId: 11033]} aptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagkv tlhfstasaspsfvvslcsaratcsasceppk
Timeline for d2alaa1: