Lineage for d2al7a1 (2al7 A:17-181)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1845935Protein ADP-ribosylation factor [52614] (16 species)
  7. 1845992Species Human (Homo sapiens), ARL8B [TaxId:9606] [142222] (1 PDB entry)
    Uniprot Q9NVJ2 18-182
  8. 1845993Domain d2al7a1: 2al7 A:17-181 [126972]
    complexed with gdp, mg

Details for d2al7a1

PDB Entry: 2al7 (more details), 1.85 Å

PDB Description: structure of human adp-ribosylation factor-like 10c
PDB Compounds: (A:) ADP-ribosylation factor-like 10C

SCOPe Domain Sequences for d2al7a1:

Sequence, based on SEQRES records: (download)

>d2al7a1 c.37.1.8 (A:17-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8B [TaxId: 9606]}
keemeltlvglqysgkttfvnviasgqfsedmiptvgfnmrkvtkgnvtikiwdiggqpr
frsmwerycrgvnaivymidaadrekieasrnelhnlldkpqlqgipvlvlgnkrdlpna
ldekqliekmnlsaiqdreiccysisckekdniditlqwliqhsk

Sequence, based on observed residues (ATOM records): (download)

>d2al7a1 c.37.1.8 (A:17-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8B [TaxId: 9606]}
keemeltlvglqysgkttfvnviavgfnmrkvtkgnvtikiwdiggqprfrsmwerycrg
vnaivymidaadrekieasrnelhnlldkpqlqgipvlvlgnkrdlpnaldekqliekmn
lsaiqdreiccysisckekdniditlqwliqhsk

SCOPe Domain Coordinates for d2al7a1:

Click to download the PDB-style file with coordinates for d2al7a1.
(The format of our PDB-style files is described here.)

Timeline for d2al7a1: