| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (8 families) ![]() |
| Family d.15.1.4: First domain of FERM [54256] (6 proteins) |
| Protein Focal adhesion kinase 1 [142960] (1 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [142961] (3 PDB entries) Uniprot Q00944 31-130 |
| Domain d2al6b3: 2al6 B:33-130 [126971] Other proteins in same PDB: d2al6a1, d2al6a2, d2al6b1, d2al6b2 automatically matched to 2AL6 A:31-130 |
PDB Entry: 2al6 (more details), 2.35 Å
SCOP Domain Sequences for d2al6b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2al6b3 d.15.1.4 (B:33-130) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]}
mervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshlqs
eevhwlhldmgvsnvrekfelahppeewkyelrirylp
Timeline for d2al6b3: