Lineage for d2al6b3 (2al6 B:33-130)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717395Family d.15.1.4: First domain of FERM [54256] (6 proteins)
  6. 717405Protein Focal adhesion kinase 1 [142960] (1 species)
  7. 717406Species Chicken (Gallus gallus) [TaxId:9031] [142961] (2 PDB entries)
  8. 717408Domain d2al6b3: 2al6 B:33-130 [126971]
    Other proteins in same PDB: d2al6a1, d2al6a2, d2al6b1, d2al6b2
    automatically matched to 2AL6 A:31-130

Details for d2al6b3

PDB Entry: 2al6 (more details), 2.35 Å

PDB Description: FERM domain of Focal Adhesion Kinase
PDB Compounds: (B:) Focal adhesion kinase 1

SCOP Domain Sequences for d2al6b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2al6b3 d.15.1.4 (B:33-130) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]}
mervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshlqs
eevhwlhldmgvsnvrekfelahppeewkyelrirylp

SCOP Domain Coordinates for d2al6b3:

Click to download the PDB-style file with coordinates for d2al6b3.
(The format of our PDB-style files is described here.)

Timeline for d2al6b3: