Lineage for d2al6b2 (2al6 B:254-375)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071416Family b.55.1.5: Third domain of FERM [50776] (8 proteins)
  6. 2071426Protein Focal adhesion kinase 1 [141432] (1 species)
  7. 2071427Species Chicken (Gallus gallus) [TaxId:9031] [141433] (2 PDB entries)
    Uniprot Q00944 254-363
  8. 2071429Domain d2al6b2: 2al6 B:254-375 [126970]
    Other proteins in same PDB: d2al6a1, d2al6a3, d2al6b1, d2al6b3
    automated match to d2al6a2

Details for d2al6b2

PDB Entry: 2al6 (more details), 2.35 Å

PDB Description: FERM domain of Focal Adhesion Kinase
PDB Compounds: (B:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2al6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2al6b2 b.55.1.5 (B:254-375) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]}
dkecfkcalgsswiisvelaigpeegisyltdkganpthladfnqvqtiqysnsedkdrk
gmlqlkiagapepltvtapsltiaenmadlidgycrlvngatqsfiirpqkegeralpsi
pk

SCOPe Domain Coordinates for d2al6b2:

Click to download the PDB-style file with coordinates for d2al6b2.
(The format of our PDB-style files is described here.)

Timeline for d2al6b2: