SCOP 1.73: Domain d2al6b2: 2al6 B:254-363

Lineage for d2al6b2 (2al6 B:254-363)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (12 families)

5. Family b.55.1.5: Third domain of FERM [50776] (8 proteins)

6. Protein Focal adhesion kinase 1 [141432] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [141433] (2 PDB entries)

8. Domain d2al6b2: 2al6 B:254-363 [126970]
   Other proteins in same PDB: d2al6a1, d2al6a3, d2al6b1, d2al6b3
   automatically matched to 2AL6 A:254-363

Details for d2al6b2

PDB Entry: 2al6, 2.35 Å

PDB Description: FERM domain of Focal Adhesion Kinase

PDB Compounds: (B:) Focal adhesion kinase 1

SCOP Domain Sequences for d2al6b2:

Sequence; same for both SEQRES and ATOM records:

>d2al6b2 b.55.1.5 (B:254-363) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]}
dkecfkcalgsswiisvelaigpeegisyltdkganpthladfnqvqtiqysnsedkdrk
gmlqlkiagapepltvtapsltiaenmadlidgycrlvngatqsfiirpq

Timeline for d2al6b2:

• d2al6b2 is new in SCOP 1.73
  
• d2al6b2 appears in SCOP 1.75
  
• d2al6b2 appears in the current release, SCOPe 2.08