Lineage for d2al6b1 (2al6 B:131-253)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764491Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 764506Superfamily a.11.2: Second domain of FERM [47031] (1 family) (S)
  5. 764507Family a.11.2.1: Second domain of FERM [47032] (8 proteins)
  6. 764517Protein Focal adhesion kinase 1 [140380] (1 species)
  7. 764518Species Chicken (Gallus gallus) [TaxId:9031] [140381] (3 PDB entries)
    Uniprot Q00944 131-253
  8. 764520Domain d2al6b1: 2al6 B:131-253 [126969]
    Other proteins in same PDB: d2al6a2, d2al6a3, d2al6b2, d2al6b3
    automatically matched to 2AL6 A:131-253

Details for d2al6b1

PDB Entry: 2al6 (more details), 2.35 Å

PDB Description: FERM domain of Focal Adhesion Kinase
PDB Compounds: (B:) Focal adhesion kinase 1

SCOP Domain Sequences for d2al6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2al6b1 a.11.2.1 (B:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]}
kgflnqftedkptlnffyqqvkndymleiadqvdqeialklgcleirrsygemrgnalek
ksnyevlekdvglrrffpkslldsvkaktlrkliqqtfrqfanlnreesilkffeilspv
yrf

SCOP Domain Coordinates for d2al6b1:

Click to download the PDB-style file with coordinates for d2al6b1.
(The format of our PDB-style files is described here.)

Timeline for d2al6b1: