SCOPe 2.08: Domain d2al6b1: 2al6 B:131-253

Lineage for d2al6b1 (2al6 B:131-253)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.2: Second domain of FERM [47031] (2 families)
   automatically mapped to Pfam PF00373

5. Family a.11.2.1: Second domain of FERM [47032] (9 proteins)

6. Protein Focal adhesion kinase 1 [140380] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [140381] (2 PDB entries)
   Uniprot Q00944 131-253

8. Domain d2al6b1: 2al6 B:131-253 [126969]
   Other proteins in same PDB: d2al6a2, d2al6a3, d2al6b2, d2al6b3
   automated match to d2al6a1

Details for d2al6b1

PDB Entry: 2al6, 2.35 Å

PDB Description: FERM domain of Focal Adhesion Kinase

PDB Compounds: (B:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2al6b1:

Sequence; same for both SEQRES and ATOM records:

>d2al6b1 a.11.2.1 (B:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]}
kgflnqftedkptlnffyqqvkndymleiadqvdqeialklgcleirrsygemrgnalek
ksnyevlekdvglrrffpkslldsvkaktlrkliqqtfrqfanlnreesilkffeilspv
yrf

Timeline for d2al6b1:

• d2al6b1 first appeared in SCOP 1.73
  
• d2al6b1 appears in SCOPe 2.07