Lineage for d2al3a1 (2al3 A:10-85)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178341Family d.15.1.2: UBX domain [54250] (6 proteins)
    Pfam PF00789
  6. 2178355Protein Tether containing UBX domain for GLUT4 (Tug) [142958] (1 species)
  7. 2178356Species Mouse (Mus musculus) [TaxId:10090] [142959] (1 PDB entry)
    Uniprot Q8VBT9 10-85
  8. 2178357Domain d2al3a1: 2al3 A:10-85 [126957]

Details for d2al3a1

PDB Entry: 2al3 (more details)

PDB Description: solution structure and backbone dynamics of an n-terminal ubiquitin- like domain in the glut4-tethering protein, tug
PDB Compounds: (A:) TUG long isoform

SCOPe Domain Sequences for d2al3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]}
savsvlapngrrhtvkvtpstvllqvledtcrrqdfnpseydlkfqrtvldlslqwrfan
lpnnaklemvpvsrsr

SCOPe Domain Coordinates for d2al3a1:

Click to download the PDB-style file with coordinates for d2al3a1.
(The format of our PDB-style files is described here.)

Timeline for d2al3a1: