Lineage for d2al1b2 (2al1 B:1-141)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860453Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 860454Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 860455Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 860500Protein Enolase [54828] (8 species)
  7. 860501Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (16 PDB entries)
  8. 860503Domain d2al1b2: 2al1 B:1-141 [126952]
    Other proteins in same PDB: d2al1a1, d2al1b1
    automatically matched to d1ebga2
    complexed with 2pg, cl, k, mg, pep

Details for d2al1b2

PDB Entry: 2al1 (more details), 1.5 Å

PDB Description: Crystal Structure Analysis of Enolase Mg Subunit Complex at pH 8.0
PDB Compounds: (B:) enolase 1

SCOP Domain Sequences for d2al1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2al1b2 d.54.1.1 (B:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

SCOP Domain Coordinates for d2al1b2:

Click to download the PDB-style file with coordinates for d2al1b2.
(The format of our PDB-style files is described here.)

Timeline for d2al1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2al1b1