Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) |
Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins) C-terminal domain is beta/alpha-barrel |
Protein Enolase [54828] (8 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (16 PDB entries) |
Domain d2al1b2: 2al1 B:1-141 [126952] Other proteins in same PDB: d2al1a1, d2al1b1 automatically matched to d1ebga2 complexed with 2pg, cl, k, mg, pep |
PDB Entry: 2al1 (more details), 1.5 Å
SCOP Domain Sequences for d2al1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2al1b2 d.54.1.1 (B:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra aaaeknvplykhladlskskt
Timeline for d2al1b2: