Lineage for d2akza2 (2akz A:1-139)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203262Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1203263Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 1203264Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1203307Protein Enolase [54828] (8 species)
  7. 1203351Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (3 PDB entries)
    Uniprot P09104
  8. 1203352Domain d2akza2: 2akz A:1-139 [126945]
    Other proteins in same PDB: d2akza1, d2akzb1
    automatically matched to d1te6a2
    complexed with f, mg, po4, trs

Details for d2akza2

PDB Entry: 2akz (more details), 1.36 Å

PDB Description: fluoride inhibition of enolase: crystal structure of the inhibitory complex
PDB Compounds: (A:) Gamma enolase

SCOPe Domain Sequences for d2akza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2akza2 d.54.1.1 (A:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

SCOPe Domain Coordinates for d2akza2:

Click to download the PDB-style file with coordinates for d2akza2.
(The format of our PDB-style files is described here.)

Timeline for d2akza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2akza1