Lineage for d2akwb3 (2akw B:39-151)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1314543Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1314851Family b.40.4.4: Myf domain [50277] (7 proteins)
  6. 1314861Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)
  7. 1314862Species Thermus thermophilus [TaxId:274] [50279] (11 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 1314868Domain d2akwb3: 2akw B:39-151 [126940]
    Other proteins in same PDB: d2akwa_, d2akwb1, d2akwb2, d2akwb4, d2akwb5, d2akwb6
    automated match to d1jjcb3
    protein/RNA complex; complexed with 200, mn, so4

Details for d2akwb3

PDB Entry: 2akw (more details), 2.8 Å

PDB Description: Crystal Structure of T.Thermophilus Phenylalanyl-tRNA synthetase complexed with p-Cl-Phenylalanine
PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d2akwb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2akwb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

SCOPe Domain Coordinates for d2akwb3:

Click to download the PDB-style file with coordinates for d2akwb3.
(The format of our PDB-style files is described here.)

Timeline for d2akwb3: