| Class b: All beta proteins [48724] (174 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
| Family b.40.4.4: Myf domain [50277] (7 proteins) |
| Protein Domain B2 of PheRS-beta, PheT [50278] (1 species) |
| Species Thermus thermophilus [TaxId:274] [50279] (11 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
| Domain d2akwb3: 2akw B:39-151 [126940] Other proteins in same PDB: d2akwa_, d2akwb1, d2akwb2, d2akwb4, d2akwb5, d2akwb6 automated match to d1jjcb3 protein/RNA complex; complexed with 200, mn, so4 |
PDB Entry: 2akw (more details), 2.8 Å
SCOPe Domain Sequences for d2akwb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2akwb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp
Timeline for d2akwb3: