Class b: All beta proteins [48724] (165 folds) |
Fold b.40: OB-fold [50198] (12 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) |
Family b.40.4.4: Myf domain [50277] (6 proteins) |
Protein Domain B2 of PheRS-beta, PheT [50278] (1 species) |
Species Thermus thermophilus [TaxId:274] [50279] (9 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
Domain d2akwb3: 2akw B:39-151 [126940] Other proteins in same PDB: d2akwa1, d2akwb1, d2akwb2, d2akwb4, d2akwb5, d2akwb6 automatically matched to d1b70b3 complexed with 200, mn, so4 |
PDB Entry: 2akw (more details), 2.8 Å
SCOP Domain Sequences for d2akwb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2akwb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]} fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp
Timeline for d2akwb3: