SCOPe 2.04: Domain d2akwb2: 2akw B:400-474

Lineage for d2akwb2 (2akw B:400-474)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
   duplication: contains two such domains related by pseudo dyad

6. Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)

7. Species Thermus thermophilus [TaxId:274] [46958] (11 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d2akwb2: 2akw B:400-474 [126939]
   Other proteins in same PDB: d2akwa_, d2akwb3, d2akwb4, d2akwb5, d2akwb6
   automated match to d1jjcb2
   protein/RNA complex; complexed with 200, mn, so4

Details for d2akwb2

PDB Entry: 2akw, 2.8 Å

PDB Description: Crystal Structure of T.Thermophilus Phenylalanyl-tRNA synthetase complexed with p-Cl-Phenylalanine

PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d2akwb2:

Sequence; same for both SEQRES and ATOM records:

>d2akwb2 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
ppeaipfrpeyanrllgtsypeaeqiailkrlgcrvegegptyrvtppshrldlrleedl
veevariqgyetipl

Timeline for d2akwb2:

• d2akwb2 first appeared in SCOP 1.73
  
• d2akwb2 appears in SCOPe 2.03
  
• d2akwb2 appears in SCOPe 2.05
  
• d2akwb2 appears in the current release, SCOPe 2.08