![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
![]() | Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [55702] (11 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
![]() | Domain d2akwa_: 2akw A: [126937] Other proteins in same PDB: d2akwb1, d2akwb2, d2akwb3, d2akwb4, d2akwb5, d2akwb6 automated match to d1jjca_ protein/RNA complex; complexed with 200, mn, so4 |
PDB Entry: 2akw (more details), 2.8 Å
SCOPe Domain Sequences for d2akwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2akwa_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]} rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam lrygipdiryffggrlkfleqfkgvl
Timeline for d2akwa_: