Lineage for d2akwa_ (2akw A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426347Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1426348Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1426349Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1426474Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species)
  7. 1426475Species Thermus thermophilus [TaxId:274] [55702] (11 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 1426481Domain d2akwa_: 2akw A: [126937]
    Other proteins in same PDB: d2akwb1, d2akwb2, d2akwb3, d2akwb4, d2akwb5, d2akwb6
    automated match to d1jjca_
    protein/RNA complex; complexed with 200, mn, so4

Details for d2akwa_

PDB Entry: 2akw (more details), 2.8 Å

PDB Description: Crystal Structure of T.Thermophilus Phenylalanyl-tRNA synthetase complexed with p-Cl-Phenylalanine
PDB Compounds: (A:) phenylalanyl-tRNA synthetase alpha chain

SCOPe Domain Sequences for d2akwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2akwa_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]}
rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
lrygipdiryffggrlkfleqfkgvl

SCOPe Domain Coordinates for d2akwa_:

Click to download the PDB-style file with coordinates for d2akwa_.
(The format of our PDB-style files is described here.)

Timeline for d2akwa_: