Lineage for d2akwa1 (2akw A:85-350)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 869604Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 869605Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) (S)
  5. 869606Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (15 proteins)
  6. 869725Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species)
  7. 869726Species Thermus thermophilus [TaxId:274] [55702] (9 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 869731Domain d2akwa1: 2akw A:85-350 [126937]
    Other proteins in same PDB: d2akwb1, d2akwb2, d2akwb3, d2akwb4, d2akwb5, d2akwb6
    automatically matched to d1eiya2
    complexed with 200, mn, so4

Details for d2akwa1

PDB Entry: 2akw (more details), 2.8 Å

PDB Description: Crystal Structure of T.Thermophilus Phenylalanyl-tRNA synthetase complexed with p-Cl-Phenylalanine
PDB Compounds: (A:) phenylalanyl-tRNA synthetase alpha chain

SCOP Domain Sequences for d2akwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2akwa1 d.104.1.1 (A:85-350) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]}
rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
lrygipdiryffggrlkfleqfkgvl

SCOP Domain Coordinates for d2akwa1:

Click to download the PDB-style file with coordinates for d2akwa1.
(The format of our PDB-style files is described here.)

Timeline for d2akwa1: