SCOPe 2.08: Domain d2akrc2: 2akr C:7-185

Lineage for d2akrc2 (2akr C:7-185)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Mouse (Mus musculus) [TaxId:10090] [54457] (25 PDB entries)

8. Domain d2akrc2: 2akr C:7-185 [126935]
   Other proteins in same PDB: d2akra1, d2akrb_, d2akrc1, d2akrd_
   automated match to d1onqa2
   complexed with cis, nag

Details for d2akrc2

PDB Entry: 2akr, 1.9 Å

PDB Description: structural basis of sulfatide presentation by mouse cd1d

PDB Compounds: (C:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d2akrc2:

Sequence; same for both SEQRES and ATOM records:

>d2akrc2 d.19.1.1 (C:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d2akrc2:

• d2akrc2 first appeared in SCOP 1.73
  
• d2akrc2 appears in SCOPe 2.07