![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein CD1, alpha-3 domain [88615] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88616] (11 PDB entries) |
![]() | Domain d2akrc1: 2akr C:186-279 [126934] Other proteins in same PDB: d2akra2, d2akrb_, d2akrc2, d2akrd_ automated match to d1onqa1 complexed with cis, nag |
PDB Entry: 2akr (more details), 1.9 Å
SCOPe Domain Sequences for d2akrc1:
Sequence, based on SEQRES records: (download)
>d2akrc1 b.1.1.2 (C:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilyw
>d2akrc1 b.1.1.2 (C:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqa tldveageeaglacrvkhsslggqdiilyw
Timeline for d2akrc1:
![]() Domains from other chains: (mouse over for more information) d2akra1, d2akra2, d2akrb_, d2akrd_ |