![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein CD1, alpha-1 and alpha-2 domains [54456] (4 species) Class I MHC-related |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [54457] (7 PDB entries) |
![]() | Domain d2akra2: 2akr A:8-185 [126932] Other proteins in same PDB: d2akra1, d2akrb_, d2akrc1, d2akrd_ automatically matched to d1cd1a2 complexed with cis, nag |
PDB Entry: 2akr (more details), 1.9 Å
SCOPe Domain Sequences for d2akra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2akra2 d.19.1.1 (A:8-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]} ytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqweklq hmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvvr fwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d2akra2:
![]() Domains from other chains: (mouse over for more information) d2akrb_, d2akrc1, d2akrc2, d2akrd_ |