Lineage for d2akra2 (2akr A:8-185)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1020841Protein CD1, alpha-1 and alpha-2 domains [54456] (4 species)
    Class I MHC-related
  7. 1020857Species Mouse (Mus musculus) [TaxId:10090] [54457] (7 PDB entries)
  8. 1020859Domain d2akra2: 2akr A:8-185 [126932]
    Other proteins in same PDB: d2akra1, d2akrb_, d2akrc1, d2akrd_
    automatically matched to d1cd1a2
    complexed with cis, nag

Details for d2akra2

PDB Entry: 2akr (more details), 1.9 Å

PDB Description: structural basis of sulfatide presentation by mouse cd1d
PDB Compounds: (A:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d2akra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2akra2 d.19.1.1 (A:8-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
ytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqweklq
hmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvvr
fwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d2akra2:

Click to download the PDB-style file with coordinates for d2akra2.
(The format of our PDB-style files is described here.)

Timeline for d2akra2: