SCOPe 2.08: Domain d2akra1: 2akr A:186-279

Lineage for d2akra1 (2akr A:186-279)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein CD1, alpha-3 domain [88615] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88616] (12 PDB entries)

8. Domain d2akra1: 2akr A:186-279 [126931]
   Other proteins in same PDB: d2akra2, d2akrb_, d2akrc2, d2akrd_
   automated match to d1onqa1
   complexed with cis, nag

Details for d2akra1

PDB Entry: 2akr, 1.9 Å

PDB Description: structural basis of sulfatide presentation by mouse cd1d

PDB Compounds: (A:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d2akra1:

Sequence, based on SEQRES records:

>d2akra1 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records):

>d2akra1 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqa
tldveageeaglacrvkhsslggqdiilyw

Timeline for d2akra1:

• d2akra1 first appeared in SCOP 1.73
  
• d2akra1 appears in SCOPe 2.07