Lineage for d2akod_ (2ako D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138062Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2138063Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2138140Family c.73.1.3: PyrH-like [142721] (4 protein domains)
    part of Pfam PF00696
  6. 2138154Protein Glutamate 5-kinase [142722] (1 species)
  7. 2138155Species Campylobacter jejuni [TaxId:197] [142723] (1 PDB entry)
    Uniprot Q9PJ29 2-251
  8. 2138159Domain d2akod_: 2ako D: [126926]
    automated match to d2akoa1
    complexed with adp

Details for d2akod_

PDB Entry: 2ako (more details), 2.2 Å

PDB Description: Crystal structure of Glutamate 5-kinase from Campylobacter jejuni
PDB Compounds: (D:) Glutamate 5-kinase

SCOPe Domain Sequences for d2akod_:

Sequence, based on SEQRES records: (download)

>d2akod_ c.73.1.3 (D:) Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]}
krivvkvgshviseentlsferlknlvaflaklmekyevilvtsaaisaghtkldidrkn
linkqvlaaigqpflisvynellakfnklggqilltgkdfdsrkatkhaknaidmminlg
ilpiinendataieeivfgdndslsayathffdadllvilsdidgfydknpsefsdakrl
ekithikeewlqatiktgsehgtggivtklkaakfllehnkkmflasgfdlsvaktflle
dkqiggtlfe

Sequence, based on observed residues (ATOM records): (download)

>d2akod_ c.73.1.3 (D:) Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]}
krivvkvgshviseentlsferlknlvaflaklmekyevilvtsaaisaghtkldidrkn
linkqvlaaigqpflisvynellakfnklggqilltgkdfdsrkatkhaknaidmminlg
ilpiinendataieeivfgdndslsayathffdadllvilsdidgfydknpsefsdakrl
ekithikeewlhgtggivtklkaakfllehnkkmflasgfdlsvaktflledkqiggtlf
e

SCOPe Domain Coordinates for d2akod_:

Click to download the PDB-style file with coordinates for d2akod_.
(The format of our PDB-style files is described here.)

Timeline for d2akod_: