Lineage for d2akoc1 (2ako C:2-251)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 843596Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 843597Superfamily c.73.1: Carbamate kinase-like [53633] (3 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 843640Family c.73.1.3: PyrH-like [142721] (3 proteins)
    part of Pfam PF00696
  6. 843654Protein Glutamate 5-kinase [142722] (1 species)
  7. 843655Species Campylobacter jejuni [TaxId:197] [142723] (1 PDB entry)
    Uniprot Q9PJ29 2-251
  8. 843658Domain d2akoc1: 2ako C:2-251 [126925]
    automatically matched to 2AKO A:2-251
    complexed with adp

Details for d2akoc1

PDB Entry: 2ako (more details), 2.2 Å

PDB Description: crystal structure of glutamate 5-kinase from campylobacter jejuni
PDB Compounds: (C:) Glutamate 5-kinase

SCOP Domain Sequences for d2akoc1:

Sequence, based on SEQRES records: (download)

>d2akoc1 c.73.1.3 (C:2-251) Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]}
krivvkvgshviseentlsferlknlvaflaklmekyevilvtsaaisaghtkldidrkn
linkqvlaaigqpflisvynellakfnklggqilltgkdfdsrkatkhaknaidmminlg
ilpiinendataieeivfgdndslsayathffdadllvilsdidgfydknpsefsdakrl
ekithikeewlqatiktgsehgtggivtklkaakfllehnkkmflasgfdlsvaktflle
dkqiggtlfe

Sequence, based on observed residues (ATOM records): (download)

>d2akoc1 c.73.1.3 (C:2-251) Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]}
krivvkvgshviseentlsferlknlvaflaklmekyevilvtsaaisaghtkldidrkn
linkqvlaaigqpflisvynellakfnklggqilltgkdfdsrkatkhaknaidmminlg
ilpiinendataieeivfgdndslsayathffdadllvilsdidgfydknpsefsdakrl
ekithikeewlhgtggivtklkaakfllehnkkmflasgfdlsvaktflledkqiggtlf
e

SCOP Domain Coordinates for d2akoc1:

Click to download the PDB-style file with coordinates for d2akoc1.
(The format of our PDB-style files is described here.)

Timeline for d2akoc1: