Lineage for d2akmb2 (2akm B:1-139)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722893Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 722894Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 722895Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 722940Protein Enolase [54828] (7 species)
  7. 722984Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (3 PDB entries)
  8. 722990Domain d2akmb2: 2akm B:1-139 [126922]
    Other proteins in same PDB: d2akma1, d2akmb1
    automatically matched to d1te6a2
    complexed with mg, po4, trs

Details for d2akmb2

PDB Entry: 2akm (more details), 1.92 Å

PDB Description: Fluoride Inhibition of Enolase: Crystal Structure of the Inhibitory Complex
PDB Compounds: (B:) Gamma enolase

SCOP Domain Sequences for d2akmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2akmb2 d.54.1.1 (B:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

SCOP Domain Coordinates for d2akmb2:

Click to download the PDB-style file with coordinates for d2akmb2.
(The format of our PDB-style files is described here.)

Timeline for d2akmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2akmb1