SCOP 1.75: Domain d2akma2: 2akm A:1-139

Lineage for d2akma2 (2akm A:1-139)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Enolase [54828] (8 species)

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (3 PDB entries)
   Uniprot P09104

8. Domain d2akma2: 2akm A:1-139 [126920]
   Other proteins in same PDB: d2akma1, d2akmb1
   automatically matched to d1te6a2
   complexed with mg, po4, trs

Details for d2akma2

PDB Entry: 2akm, 1.92 Å

PDB Description: Fluoride Inhibition of Enolase: Crystal Structure of the Inhibitory Complex

PDB Compounds: (A:) Gamma enolase

SCOP Domain Sequences for d2akma2:

Sequence; same for both SEQRES and ATOM records:

>d2akma2 d.54.1.1 (A:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

Timeline for d2akma2:

• d2akma2 first appeared in SCOP 1.73
  
• d2akma2 appears in SCOPe 2.01
  
• d2akma2 appears in the current release, SCOPe 2.08