Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.94: HPr-like [55593] (2 superfamilies) beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423 |
Superfamily d.94.1: HPr-like [55594] (1 family) |
Family d.94.1.1: HPr-like [55595] (2 proteins) |
Protein Crh, catabolite repression HPr-like protein [69783] (1 species) |
Species Bacillus subtilis [TaxId:1423] [69784] (6 PDB entries) |
Domain d2ak7b1: 2ak7 B:1-86 [126913] automatically matched to d1mo1a_ complexed with so4 |
PDB Entry: 2ak7 (more details), 2 Å
SCOP Domain Sequences for d2ak7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ak7b1 d.94.1.1 (B:1-86) Crh, catabolite repression HPr-like protein {Bacillus subtilis [TaxId: 1423]} mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte vtliaqgedeqealeklaayvqeevl
Timeline for d2ak7b1: