SCOP 1.73: Domain d2ak7b1: 2ak7 B:1-86

Lineage for d2ak7b1 (2ak7 B:1-86)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (1 family)

5. Family d.94.1.1: HPr-like [55595] (2 proteins)

6. Protein Crh, catabolite repression HPr-like protein [69783] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [69784] (4 PDB entries)

8. Domain d2ak7b1: 2ak7 B:1-86 [126913]
   automatically matched to d1mo1a_
   complexed with so4

Details for d2ak7b1

PDB Entry: 2ak7, 2 Å

PDB Description: structure of a dimeric P-Ser-Crh

PDB Compounds: (B:) HPr-like protein crh

SCOP Domain Sequences for d2ak7b1:

Sequence; same for both SEQRES and ATOM records:

>d2ak7b1 d.94.1.1 (B:1-86) Crh, catabolite repression HPr-like protein {Bacillus subtilis [TaxId: 1423]}
mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
vtliaqgedeqealeklaayvqeevl

Timeline for d2ak7b1:

• d2ak7b1 is new in SCOP 1.73
  
• d2ak7b1 appears in SCOP 1.75
  
• d2ak7b1 appears in the current release, SCOPe 2.08, called d2ak7b2