Lineage for d2ak7a2 (2ak7 A:1-85)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2207038Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 2207039Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 2207040Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 2207041Protein Crh, catabolite repression HPr-like protein [69783] (1 species)
  7. 2207042Species Bacillus subtilis [TaxId:1423] [69784] (6 PDB entries)
  8. 2207049Domain d2ak7a2: 2ak7 A:1-85 [126912]
    Other proteins in same PDB: d2ak7a3, d2ak7b3
    automated match to d1mo1a_
    complexed with so4

Details for d2ak7a2

PDB Entry: 2ak7 (more details), 2 Å

PDB Description: structure of a dimeric P-Ser-Crh
PDB Compounds: (A:) HPr-like protein crh

SCOPe Domain Sequences for d2ak7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ak7a2 d.94.1.1 (A:1-85) Crh, catabolite repression HPr-like protein {Bacillus subtilis [TaxId: 1423]}
mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
vtliaqgedeqealeklaayvqeev

SCOPe Domain Coordinates for d2ak7a2:

Click to download the PDB-style file with coordinates for d2ak7a2.
(The format of our PDB-style files is described here.)

Timeline for d2ak7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ak7a3