Lineage for d2ak7a1 (2ak7 A:1-86)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730020Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 730021Superfamily d.94.1: HPr-like [55594] (1 family) (S)
  5. 730022Family d.94.1.1: HPr-like [55595] (2 proteins)
  6. 730023Protein Crh, catabolite repression HPr-like protein [69783] (1 species)
  7. 730024Species Bacillus subtilis [TaxId:1423] [69784] (4 PDB entries)
  8. 730031Domain d2ak7a1: 2ak7 A:1-86 [126912]
    automatically matched to d1mo1a_
    complexed with so4

Details for d2ak7a1

PDB Entry: 2ak7 (more details), 2 Å

PDB Description: structure of a dimeric P-Ser-Crh
PDB Compounds: (A:) HPr-like protein crh

SCOP Domain Sequences for d2ak7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ak7a1 d.94.1.1 (A:1-86) Crh, catabolite repression HPr-like protein {Bacillus subtilis [TaxId: 1423]}
mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
vtliaqgedeqealeklaayvqeevl

SCOP Domain Coordinates for d2ak7a1:

Click to download the PDB-style file with coordinates for d2ak7a1.
(The format of our PDB-style files is described here.)

Timeline for d2ak7a1: