Lineage for d2ak4q2 (2ak4 Q:1-181)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897285Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1897508Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (23 PDB entries)
  8. 1897534Domain d2ak4q2: 2ak4 Q:1-181 [126910]
    Other proteins in same PDB: d2ak4a1, d2ak4b_, d2ak4d1, d2ak4d2, d2ak4e1, d2ak4e2, d2ak4f1, d2ak4g_, d2ak4i1, d2ak4i2, d2ak4j1, d2ak4j2, d2ak4k1, d2ak4l_, d2ak4n1, d2ak4n2, d2ak4p1, d2ak4p2, d2ak4q1, d2ak4r_, d2ak4t1, d2ak4t2, d2ak4u1, d2ak4u2
    automatically matched to d1a1ma2
    complexed with iod

Details for d2ak4q2

PDB Entry: 2ak4 (more details), 2.5 Å

PDB Description: Crystal Structure of SB27 TCR in complex with HLA-B*3508-13mer peptide
PDB Compounds: (Q:) HLA-B35 variant

SCOPe Domain Sequences for d2ak4q2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ak4q2 d.19.1.1 (Q:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqrrayleglcvewlrrylengketlq
r

SCOPe Domain Coordinates for d2ak4q2:

Click to download the PDB-style file with coordinates for d2ak4q2.
(The format of our PDB-style files is described here.)

Timeline for d2ak4q2: